SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004143 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004143
Domain Number 1 Region: 388-501
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-26
Family PDZ domain 0.0077
Further Details:      
 
Domain Number 2 Region: 8-115
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-23
Family PDZ domain 0.00035
Further Details:      
 
Domain Number 3 Region: 227-296
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-17
Family PDZ domain 0.018
Further Details:      
 
Domain Number 4 Region: 684-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000124
Family Nucleotide and nucleoside kinases 0.0021
Further Details:      
 
Domain Number 5 Region: 502-578
Classification Level Classification E-value
Superfamily SH3-domain 0.000000194
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004143   Gene: ENSTTRG00000004394   Transcript: ENSTTRT00000004399
Sequence length 943
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_652:14022:30946:1 gene:ENSTTRG00000004394 transcript:ENSTTRT00000004399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDLMSTFPVTSHQVLDMEELTIWEQHTVTISKDPRRGFGIAISGGRDRPGGSVVVSDVVP
GGPAEGRLQTGDHIVMVNGVSMESVTSTFAIQILKTCTKVANITVKRPRKVQLPATKATS
GLGHQDSDEEDGPRRLDEADHGQGYEGDTSSGSGHSWGERSRRPRTGRRSQASSHGRRSP
SGGSEANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGVRLGSQIFIKHITESGL
AAQNSRLREGDLILQINGVSSENLSLSDTRQLIEKSEGKLTLLVLRDRGQFLVNIPPAVS
DSDSSLLEEGVPVAETRFPADISDLGSELSQAPPSHVPPPPQHGQQSPDASRTSSPMESP
QLRQEGSVDSRTPSEPGESPRQRSCDMHSVPSGQSVEDHGYSPASRVVRFLKGANIGLRL
AGGNDVGIFVSGVQAGSPADGQGIQEGDEILQVNDTPFRNLTREEAVQFLLELPPGEEVE
LVTQRKQDIFRKMVQSGVGDSFYIRMHFEMEPSPPSGLGFTRGDVFHVLDTLYPGPGQSH
ARGGHWLAVRMGRDLREKERGIIPSQSRAEQLASLEAAQRAVGVGPGASAGSSTRAEFWR
LRGLRRGAKKTTHRSREDLSALTRQGHYPPYERVVLREASFKRPVVILGPVADIAMQKLT
AEMPDEFEIAESMSRTDSPSKIIKLDTVRVIAEKDKHALLDVTPSAIERLNYVQYYPIVV
FCVPESRTALKALRQWLAPASRRSSRRLYAQAQKLRKHSDHLFTATIPLQGTSDSWYKEL
KAVIREQQTRPIWTAEDQLDSSSEDNLDLPYRSLADSSADLSCDSRLNSDYETDGEGGVY
TDGEGYTDGEGGPHMDVDEGPPAPALARSSEPVLEDEPRILQDHGRSSGHQGTQVDGHHP
QGQRRQDSMRTYERDALRKKFTRARDVESSDEDGYDWGPATDL
Download sequence
Identical sequences ENSTTRP00000004143 ENSTTRP00000004143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]