SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004211 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004211
Domain Number 1 Region: 553-691
Classification Level Classification E-value
Superfamily PX domain 5.63e-22
Family PX domain 0.0022
Further Details:      
 
Domain Number 2 Region: 328-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-21
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004211   Gene: ENSTTRG00000004469   Transcript: ENSTTRT00000004469
Sequence length 946
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1387:57690:124261:-1 gene:ENSTTRG00000004469 transcript:ENSTTRT00000004469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWVRTLGEKLKQRLRLDVGREICRQYPMFCFLLLCLSAASLLLNRYLHVLMIFWSFVA
GVVTFYCSLGPDSLLPNIFFTIKYKPKQLGLQELFPQGRSCAVCGKVKCKRHRPALLLEN
YQPWLDLKISSKVDASLSEVLELVLENFIYPWYRDVTDDESFVDELRIILRFFASVLIRR
IHKVDIPSIITKKLLKAAMKHIEVIVKASQKVENTEFLQQAALEEYGPELHVALRSRRDE
LHYLRKLTELLFPYILPPKATDCRSLTLLLREILSGSVFLPSLDFLADPDTVNHLLIIFI
DDSPPEKATEPPSPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQICLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
KIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
LNRSSLSLDDFRSTQKRGESFGISRIGSKIKGVFKSTTMEGAMLPNYGLAEGEDDFIEEG
IVVMEDDSPVEAVNTPNTPRNLAAWKISIPYVDFFEDTSSERKEKKERIPVFCIDVERND
RRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEF
QEYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLIKEKGQH
LETFIMNFINSCESPKPKPSKPELTILSPTSENNKKLFNDLFKNNANRAENTERKQNQNY
FMEMMTLEGVYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYLHCKLEQLFQ
EHRLVSLITLLRDAVFCENTEPRSLQDKQKRAKQTFEEMMNYIPDLIVKCIGEEAKYESI
RLLFDGLQQPVLNKQLTYVLLDIVIQELFPELSKVQKEVTSVTSWM
Download sequence
Identical sequences ENSTTRP00000004211 ENSTTRP00000004211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]