SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004237 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004237
Domain Number 1 Region: 191-501
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.54e-118
Family Transglutaminase core 0.0000000000212
Further Details:      
 
Domain Number 2 Region: 9-190
Classification Level Classification E-value
Superfamily E set domains 2.13e-55
Family Transglutaminase N-terminal domain 0.0000000254
Further Details:      
 
Domain Number 3 Region: 516-627
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.31e-32
Family Transglutaminase, two C-terminal domains 0.00000286
Further Details:      
 
Domain Number 4 Region: 629-726
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.22e-27
Family Transglutaminase, two C-terminal domains 0.00000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004237   Gene: ENSTTRG00000004498   Transcript: ENSTTRT00000004499
Sequence length 731
Comment pep:known_by_projection scaffold:turTru1:scaffold_113215:20184:154151:-1 gene:ENSTTRG00000004498 transcript:ENSTTRT00000004499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSGATFGGRRAIPPNTSNASENDPPTMELHGLVPRGFNLQDYLNVTGVHLFKERWDS
NKVDHHTDKYSNNKLIVRRGQSFYIQIDFNRPYNPRDLFTMEYVIGRYPQENKGTYIPVS
VVSELQSGKWGAKVITREDRSVRLSIQSSPDCIVGKFRMYVAVWTPYGVIRTSRNPETDT
YILFNPWCEEDAVYLDNEKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACLY
VMDRANMDLSGRGNPIKVSRVGSAMINAKDDEGVIAGCWDNVYAYGIPPSAWTGSVDILL
EYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQLDIFLEEDGNV
NSKLTKDSVWNYHCWNEAWMTRPDLPIGFGGWQVVDSTPQENSDGMYRCGPASVQAIKHG
NVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVETLDTTHIGKLIVTKQVGGDGIKDITDT
YKFQEGQEEERLALETALMYGAKKPLNTEGVVKSRSDVHMNFEVENVVLGRDFKVTITFR
NNGPAHYTITAYLSGNITFYTGVAKAEFKNKTFDVTLEPLSFKKEEVLIQAGEYMGELLE
QAFLHFFVTARVNETKDVLAKQKSIVLTIPKVIIKVHGAQVVGSDMVVTVEFTNPLKETL
KNIWIYLDGPGVTKPKRKMFQEIRPNSTVKWEEVCRPWVSGPRKLMASLTSDSLRHVYGE
LDLQIQRRPPM
Download sequence
Identical sequences ENSTTRP00000004237 ENSTTRP00000004237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]