SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004331 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004331
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 386-446
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000011
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004331   Gene: ENSTTRG00000004590   Transcript: ENSTTRT00000004597
Sequence length 458
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_65:11401:19192:1 gene:ENSTTRG00000004590 transcript:ENSTTRT00000004597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLATAVVQLYLALPRGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDCQAGLNFADEGEAQAFRTLVQEKIQKRNQRQSGDRRQLPPPPV
PANEERRGGLPPLPPHPGGDQGGPSSGSLSLGLVTVDIHNPYITNSRYRGLPAPGPIPGD
NKRSWNKKISKADIGAPSGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP
SSGVGPIAPPPPPPLGLVGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSE
GLVGALMHVMQKRSRAIHSSDEGEDQAGDDDEDDEWDD
Download sequence
Identical sequences ENSTTRP00000004331 ENSTTRP00000004331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]