SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004386 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004386
Domain Number 1 Region: 275-394
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.94e-25
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004386   Gene: ENSTTRG00000004646   Transcript: ENSTTRT00000004654
Sequence length 834
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1970:99762:168063:1 gene:ENSTTRG00000004646 transcript:ENSTTRT00000004654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVFDYSYRDYILSWYGSLSRDEGQLYHLLSEDFWEVVRRLRHRLSRVDMVRVVCSDVVRA
LLAHFCDLKAADARHEEQPRPFVLHAFLRNSDDEVRFLQTCSRVLVFCLLPSKDVQSLSL
RIMLAEILTAKVLKPVVELLSNPDYINQMLLAQLEHREQVNEHHKRAYTYAPSYEEFIKL
INSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNMKRYINQ
LTVAKKQCEKRIRILGGPAYDQQEDGPLDEGEGPQSQKILQFEDILANASYREHFRTYME
RMDKRALISFWESVEYLKNAHKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGN
KGIEVFCKIQGDVYEMLKDRYYPSFIVSDLYEKLMIKEEEKHVSQLISNKDEMNPGGEAG
EESVDDGTSRINEQTSFAVNKLRELNEKLDYKRQALNSIQNAPKPDKKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLL
SDERLCQSEALYAFLSPSPDYLKVIDVQGKKSTFSLSSFLERLPRDFFSHXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKWVRRTLIALVQVTFGRTINKQLRDAV
DWALSEQMVVYYIGALRDALWPGGNLAPPNTIPSEEQSQETKRRAQQKLLENIPDMLQSL
VGQQNARHGIIKIFNALQETRANKHLLYVLMELLLIELCPELRTHLDELKACQV
Download sequence
Identical sequences ENSTTRP00000004386 ENSTTRP00000004386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]