SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004395 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004395
Domain Number 1 Region: 504-597
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000144
Family Transglutaminase, two C-terminal domains 0.0029
Further Details:      
 
Domain Number 2 Region: 19-78
Classification Level Classification E-value
Superfamily E set domains 0.0000000455
Family Transglutaminase N-terminal domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004395
Domain Number - Region: 396-492
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0507
Family Transglutaminase, two C-terminal domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004395   Gene: ENSTTRG00000004645   Transcript: ENSTTRT00000004664
Sequence length 598
Comment pep:novel genescaffold:turTru1:GeneScaffold_2619:13999:34605:1 gene:ENSTTRG00000004645 transcript:ENSTTRT00000004664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLGVSNNIMMELDPRSSDRCPWQAAIHNESSVEVKVVVGSPRAVVGKYHLLVKSGNKHI
FKSEENMLYLLFNPWCEEDVVFTANETENESVPHSTGYCYICCVDSVKKPWNFGQCCICL
SSQILLETMELKHPTPGSRTLCALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSPEEREVMDHAFSYCRYESEYKLPPKEDLLMYVQADPVLLGNPIKFTITLKR
KTATPKTVISGSLELQTYTIKNATSLGIFHKTTQRQGQAPEETVPLDSNTYMGSMFDDEP
IISSIIAILESETTSSQEFASFQYPELPVXLPDTGRIGQPLIGTYIFNAPHIPLTDTKSS
VESLGVSLLTIDQGTVKPGETIRFQIKGIPTIAGLEKFIKFSSNQVKEVHAEKTVLIN
Download sequence
Identical sequences ENSTTRP00000004395 ENSTTRP00000004395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]