SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004427 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004427
Domain Number 1 Region: 163-329
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-43
Family Protein kinases, catalytic subunit 0.0000459
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.56e-35
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004427   Gene: ENSTTRG00000004708   Transcript: ENSTTRT00000004697
Sequence length 329
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2022:139453:143933:1 gene:ENSTTRG00000004708 transcript:ENSTTRT00000004697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGSLETVVANSAFIAARTSFDASSGPTSRDRKYLARLKLSPLSKCGALQASLDLGFES
VCSEQPIGKRLFQQFLQAQEQHVPALELWRDIEVYNTAGDDLRPQKAQAIRAEYLDPQAK
LFCGFLDKEMVAQVREGPAGAGDGLFQPLLQATLAHLSQAPFQQYLDSLYFQRFLQWKWL
EAQPVGEDWFLDFRVLGRGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYKGAMVEKK
ILAKVHSRFIVSLAYAFETKTDLCLVMTVMNGGDIRYHIYNVDEENPGFPEARALFYTAQ
IISGLEHLHQRGIIYRDLKPENVLLDDDG
Download sequence
Identical sequences ENSTTRP00000004427 ENSTTRP00000004427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]