SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004429 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004429
Domain Number 1 Region: 1063-1271
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-52
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 1722-1961
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000134
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 1266-1361
Classification Level Classification E-value
Superfamily PH domain-like 0.00000232
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004429   Gene: ENSTTRG00000004663   Transcript: ENSTTRT00000004699
Sequence length 2046
Comment pep:known_by_projection scaffold:turTru1:scaffold_114919:160351:217584:-1 gene:ENSTTRG00000004663 transcript:ENSTTRT00000004699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGAPRPQLYRSMSFKLLERWSGGPGPREEATDASGLRRRASCRPVSDVAGQPSRGVSK
LACEPPATNHAPRPLRSFSAGRPLSRRFDQHLDDSATGARDGVSPGAAEEAGGGAARGAW
PSVTEMRKLFGGPSRRPSADSEASGTPSPDGAAWEPTTREPRQPPTPPPRTCFPLAGLRS
ARPLPGPGTEGRRRRQQQQQQQQQQERAQRPADGLHSWHSFSQPQAWARAYRSSSSSIVS
SYPVSSSRTASSSEEEEEGPPPPQPGAQSPAYHGGHSSGSDEDQDGEGGHCWGGRPGPRP
RSSLLDKDCRPDSYGLNLGSMDSARGARSPDPPTSPRAPREEGPQEWGTGSPPCEPGPQE
GLRPLSDTVGGTFRVAKVSFPTYLASPAGSRGSSRYSSTETLKEEDLWASRSSGSWGVYR
SPSFGAGEGLLRPQARTRTKGPVGTTRALRDGGLELDKSRQRKSLSNPDIASETLTLLSF
LRSDLSELRVRKPGGRHEDLGSGPLDGRDSPSAGGSVGQLEPMPSPAPASSGTRPTLKDL
TATLRRAKSFTCSEKPMARRLLRTSALKPSSSELLLAGPGAEEDPLPLVVQDQYVQEARQ
VFEKIQRMGAQDDDGSDVLPGSPDWAGDVIRGQRSQEELSGPESSLTDEGIGADPEPPVS
AFCSLDTAGVWRPLSSSSAQTNHHGPGAEDSLGGWAQVSSDTPPTPGALRRRRKAPPSGP
GGTDLSNGEAGEAYRSLSDPIPQRHRAAPSEEPSGFSVDSNLLGSLSPKTGLPAAPAVDE
GLTSGHSDWSVGSEESKGYQEVIQSIVQGPGALGCVVDDRAAGKAPKKKSLSDPSRRGEL
AGPGFEGPGGEPIREVEPMLPPSSSEPILTERRAEPEEPSPARGRAQSERALPEAPPASS
TAHRDFHLDPKLADVLSPRLIRRGSKKRPARSSHQELPREEGIQDQAGSLSRARPSSKHV
RHASVPSTFTPIMVPEPPTSVGPPVAVPEPMGFPAQAHPTLQAPSLEDVTKQYVLTLHSS
EVPAPVPVDMPCLTPIAPPSAEAKPPETVRAPDEPAPASKCCSKPQVDMRKHVTMTLLDT
EQSYVESLRTLMQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLAHHEQFLEQVRHCVQT
WHAQQKVGDLLVQSFSKDVLVNIYSAYVDNFLNAKDAVRVAKEARPAFLKFLEQSMRENK
EKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRSIKQVAERINKGVRS
AEAERHARVLQEIEPIEGMDLQAPLRRFLRQEMVIEVKAVGGKKDRSLFLFTDLIICTTL
KRKSGSLRRSSMSLYTAASVIDTASKYKLLWKLPLEDADIIKGASQAANRENIQKAISRL
DEDLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKLELCT
TRPEGTDSFIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFS
CAAPTLSSCPEPTPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQ
RRCHRERTASLRNPPETAPEPPGPELDVEAAYEESATLAEPGPNPCLHIFLAGSGPGDHP
GSPEGPPPGXXXXXXXXXXXXXXXXXXXXEEAPSSKEATAEATSSEEEQEPGFPPLSGSF
GPGSPCGTSPMDGRALRRSSRGSFTRGSLEDLLSVEPEAYQSSVWLGTEDGCVHVYQSSD
SIRDRRNSLKLQHAASVTCILYLNNQVFVSLANGELVVYQREVGHFWDPQNFKSVTLGAQ
GSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFSVGQDSSRSVACMVDSSLGVWVTL
KGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVG
TSAGVVLTMPTSPSTVSCPRAPLSPAGLGQGHTGHVRFLAAVQLPDGFNLLCSTPPPPPD
TGPEKLPSLEHRDSPRHRGPASARPKMLVISGGDGYEDFRLSSGGGGSSETVGRDDSTNH
LLLWRV
Download sequence
Identical sequences ENSTTRP00000004429 ENSTTRP00000004429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]