SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004455 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004455
Domain Number 1 Region: 53-211
Classification Level Classification E-value
Superfamily CBS-domain pair 9.03e-43
Family CBS-domain pair 0.000000052
Further Details:      
 
Domain Number 2 Region: 215-350
Classification Level Classification E-value
Superfamily CBS-domain pair 5e-27
Family CBS-domain pair 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004455   Gene: ENSTTRG00000004730   Transcript: ENSTTRT00000004727
Sequence length 356
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2810:159504:173482:-1 gene:ENSTTRG00000004730 transcript:ENSTTRT00000004727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGRGAGPSPPPSPGKLPKANEPSASVAMEAVTSSDNYSALENEHPQETPESNNSVYTSFM
KSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFIN
ILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRL
PVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPV
YVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVIXXXXXXXXXXXXXXXXXXXXHRSHHF
EGLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKP
Download sequence
Identical sequences ENSTTRP00000004455 ENSTTRP00000004455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]