SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004480 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004480
Domain Number 1 Region: 1213-1435
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-63
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 2 Region: 1435-1575
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-33
Family Pleckstrin-homology domain (PH domain) 0.000000217
Further Details:      
 
Domain Number 3 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 1.76e-29
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 1589-1709
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-26
Family PLC-like (P variant) 0.01
Further Details:      
 
Domain Number 5 Region: 1132-1218
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-26
Family SH3-domain 0.0000598
Further Details:      
 
Domain Number 6 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 7.22e-26
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 735-812
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-19
Family SH3-domain 0.00017
Further Details:      
 
Domain Number 8 Region: 908-970
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 9 Region: 993-1055
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-19
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 10 Region: 1069-1137
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-17
Family SH3-domain 0.0000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004480   Gene: ENSTTRG00000004735   Transcript: ENSTTRT00000004754
Sequence length 1716
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1656:244311:399691:1 gene:ENSTTRG00000004735 transcript:ENSTTRT00000004754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSTLPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPAAGVPPLANGTPPVIQPLPAFTHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPAAEWAVPQPSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEIDIFN
NQLKELREIHNKQQLQKQKSIEAERLKQKEQERKIIELEKQKGEAQRRAQERDQQWLEHV
QQEDEHQRPRKPHEEEKLKREESVKKKESEEKGKQEMQDKLSRLFHQQEPAKPAVQAPWS
TAEKGPLSISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVIECLVDESQTGEPGWL
GGELKGKTGWFPANYAEKIPENEVPAPVKPVTDAASTPAPKLALRETPAPSAVTSAEPST
TPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSP
VLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSY
VKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPAVSGEEFIAMYTYESSEQGDLTFQQ
GDVILVTKKDGDWWTGTVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASY
TATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGMSKITP
TEPPKPAAFPAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVHGQVGLFP
SNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQK
PLMESELLTEKEGAMIFVNWKDLIMCNIKLLKALRVRKKMSGEKMPVKMIGDILTAQLPH
MQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRY
PLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGL
SEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGTDKVF
SPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQK
IKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM
GSQCHITKTIQDTLNPKWNSNCQFFIKDLEQEVLCITVFERDQFSPDDFLGRTEIRVADI
KKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences ENSTTRP00000004480 ENSTTRP00000004480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]