SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004541 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004541
Domain Number 1 Region: 425-683
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-72
Family Eukaryotic proteases 0.0000000205
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-30
Family Spermadhesin, CUB domain 0.00000072
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-24
Family Spermadhesin, CUB domain 0.0000856
Further Details:      
 
Domain Number 4 Region: 359-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.0000406
Further Details:      
 
Domain Number 5 Region: 299-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000648
Family EGF-type module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004541   Gene: ENSTTRG00000004816   Transcript: ENSTTRT00000004817
Sequence length 689
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_47:225959:233901:1 gene:ENSTTRG00000004816 transcript:ENSTTRT00000004817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIVLFSLLAWVYAEPAMYGEILSPNYPQAYPNEVKKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIMSGGLEEGKLCGQRTSKNPNSPVVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVAVDVNECTDFADSPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVF
TTPIGELTSPNYPSLYPENSRCDYQILLEEGFQVVVTMQREDFDVEPADSEGRCADSLLF
VAGNQQFGPYCGNGFPGPLTIETKSNALNIIFQTDETEQKKGWKFRYHGDPIPCPKEVTA
NSFWEPDRAKYVFKDVVKITCVDGFEVVQGSVGLTSFYSTCQSNGKWSNSKLRCQPVDCG
APEPIRHGRVEDPENTLFGSVTRYTCEQPYYYMENERSEEYRCAGNGSWVNELLGAELPK
CIPVCGVPGEPFTEKQRIFGGSMAKIENFPWQVFFSNPRAGGALIDEYWVLTAAHTVEGN
RDPVMYVGSTSVVTSQLAKAQMLTAEKVFIHPGWKVLDASEARKNFDNDIALVRLQDPVK
MGPTVSPICLPGTSSEYNPSVGDLGLISGWGRTNTKDHVIKLRGAKLPIAPLAKCRELKG
LSSGIDINSFVFTENMICAGGEKGVDSCEGDSGGAFALQVPNEENTKFYVAGLVSWGPQC
GTYGIYTRVKNYVDWIMKTMQENSAPGGG
Download sequence
Identical sequences ENSTTRP00000004541 ENSTTRP00000004541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]