SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004545 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004545
Domain Number 1 Region: 225-480
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.3e-65
Family Eukaryotic proteases 0.000000225
Further Details:      
 
Domain Number 2 Region: 47-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-23
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004545
Domain Number - Region: 186-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00206
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004545   Gene: ENSTTRG00000004821   Transcript: ENSTTRT00000004821
Sequence length 483
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_47:250361:261602:-1 gene:ENSTTRG00000004821 transcript:ENSTTRT00000004821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLRAGNCLWGSHSTRCPGNTWWLFLWGVLQACPTQGSVLLAQPLPQKLMSPGYPEPYV
KGQESSTDIEAPEGFAVRLVFQDFDLEPSPDCDQDYVSITASGMDPSRFCGQQGSLLGSP
PGQREFVSSGNSLRLTFRSPASEDRTPGLHKGFLALYQAVGMNHSQPISQASGDPEAMNT
PGDNSTEIQSHCQEPYYQAMPIGTLTCTAQVPWKQTQEREEVRRCVPVCGRPVIPIAQNR
EPVGASRAELGNFPWQALTSIYGRGGGALLGDRWILTAAHTIYPKDGIFLGKSRRAEVFL
GHTNIDELLELGGHPVRRVVVHPDYRPDQTHNFHGDIALLELRHSVPLGPHLLPVCLPDR
KALYRPGLAGYVSGFGVENGWLTTELKYSQVPVAPRAACEAWLREKRRTEVFSGGMFCAG
DSTRPQSVCQGDSGGAYVVWDDRARRWVATGIVSWGIGCGEGYGFYTKVLNYVDWIRGVM
GGK
Download sequence
Identical sequences ENSTTRP00000004545 ENSTTRP00000004545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]