SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004633 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004633
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.71e-65
Family LplA-like 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004633   Gene: ENSTTRG00000004919   Transcript: ENSTTRT00000004913
Sequence length 373
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2650:24024:25145:1 gene:ENSTTRG00000004919 transcript:ENSTTRT00000004913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSMKNCFQLLCNLKVPAAGFKDTVKSGLILQSVSNNVYQNLAVEDWIHDHMNLEAK
PVLFFWRNSPSVVIGRHQNPWQECNLNLMREGGVKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLVVKALKAVQPQLDVRATKRFDLLLDGQFKISGTASRIGQTAAYHHCTL
LCSTDGTFLSSLLKSPYQGVRSTATASTPALVKNLMEKDPTLTCEVVINAIATEYATSHQ
IDNHIHLINPTDETLFPGINSRAKELQTWEWIYGKTPKFSVNTSFNVLYEHSHLEIKVFI
DIKNGRIEICNIEAPDHWLPLEIRDKLNSGFIGSKFCPIETTMLTSILHRTCPEDDELHS
KWNMLCEKIKGIM
Download sequence
Identical sequences ENSTTRP00000004633 XP_019786752.1.83887 XP_019786753.1.83887 ENSTTRP00000004633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]