SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004746 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004746
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-17
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004746   Gene: ENSTTRG00000005038   Transcript: ENSTTRT00000005036
Sequence length 160
Comment pep:known_by_projection scaffold:turTru1:scaffold_114979:8046:18586:1 gene:ENSTTRG00000005038 transcript:ENSTTRT00000005036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRD
VHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIR
GTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
Download sequence
Identical sequences ENSTTRP00000004746 ENSTTRP00000004746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]