SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004784 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004784
Domain Number 1 Region: 52-454
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.25e-91
Family L-arabinose binding protein-like 0.00056
Further Details:      
 
Domain Number 2 Region: 560-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.88e-50
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 3 Region: 870-1018
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.58e-50
Family Adenylyl and guanylyl cyclase catalytic domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004784   Gene: ENSTTRG00000005062   Transcript: ENSTTRT00000005074
Sequence length 1108
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_551:189636:271182:-1 gene:ENSTTRG00000005062 transcript:ENSTTRT00000005074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLGPWPFSHLMLWFAAPGRQRGLRGLASFKLLWCLCLLALTSLPQRIWAPPYKIGVVGP
WTCDPLFSKALPEVAARLAIERINKDPSFDLGYSFEYVILNEDCQASRALSSFISHHQMA
SGFIGPANPGYCEAASLLGNSWDKGIFSWACVNYELDNKNSHPTFSRTLPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVHTAHRVASALRSRGLPVGVVLTTGQDSQSIQKALQRIRQAD
RILIIIMCMHSTLIGGETQTHLLEWAHDLKMTDGTYVFVPYDALLYSLPYKHTSYQVLRN
NPKLREAYDAVLTITVESQEKTFYQAFMEAAARGEIPEKLESDQVSPLFGTIYNSIYFIA
QAMNNAMKENGRASAASLVQHSRNMQFYGFNQLIRTDSNGNGISEYVILDTNWKEWELHS
TYTVDMETELLRFRETPIHFPGGRPPQADAKCWFAEGKICQGGIDPAFAVMVCLALLIAL
LSINGFAYFIRRRINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSRVSVSFQITSEVQS
GRYPRLSFSSGSLTPAIYENSNIAIYEGDWVWLKKFPSGDFGDIKSIKSSASDMFEMMKD
LRHENINPLVGFFYDSGMFAIVTEFCSRRSLEDILTNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFAHGRLKSRNCVVDGRFVLKVTDYGFNDILETLRLSQEEPSAEELLWMAPELLRA
PRGSRLRSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAKEIIERLKKPPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSNNLEDLIR
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGMRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVAAGVVGLTMPRYCLFGDTVNTASRMESTGLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKGTEETFWLVGKKGFTKPLPVPPPVGKDG
QVGHGLQPVEIAAFQRRKAEKQLVRNKP
Download sequence
Identical sequences ENSTTRP00000004784 ENSTTRP00000004784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]