SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004802 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004802
Domain Number 1 Region: 869-1079
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-54
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1068-1188
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 1251-1373
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000396
Family Pleckstrin-homology domain (PH domain) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004802   Gene: ENSTTRG00000005069   Transcript: ENSTTRT00000005092
Sequence length 1432
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2977:809:104483:-1 gene:ENSTTRG00000005069 transcript:ENSTTRT00000005092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAEIKKPPVAPKPKFVVANNKPAPPPVAPKPEIVVSSVPQSTKKTKPAIAPKPKVLK
ASPVQDIRRSPSRKIIVNLEEHKQESPESIDNSSCKNRGHQSSDYILPMCSCRSECNHKL
GNRENLCVKQLVLGPLEMHENLENNKIGESSSAIKTQRKCDSNDEKIKSQSEVVLKASIL
EEKLKDVLTQRTSPFIFPQKHRFTDSPEMSDGCNSNRQFRIEFADLSPSLSSFEKVSDHH
HCHLQLPSDEFQNFEANQGDNEKSNTHFHSSEQEALENGKRSTFLSSDGDIKKSEVKDLG
PLEIHLVPYTPKFPTPKPRKTRAARLLRQKQIDTPSESNEEPENVDSSSLCLFEDSLKNN
KISVFHRNVLCNQEQVDKVKPGNKSELNVDFNGDRQNLINSQKPLSPETSSFENMPSPLE
TDSNLNSDKTGDGSSMSPAVDKRTSFIRCSTLSMSLPKQLKLTCTEHLPTACNRGVSAPQ
LQKESMIKDESSSRIVPKKPQRHSLPAAGVLKKAASEELVEKSSYPSNEEKSSEKGLERN
HLQHLCAQNRGVSSSFDIPKRASEKPVWKLPHPIIPFSGNPESLKSVTVSSNSEPPTALT
KPRAKSLSAVDVERCTKPCKDSQKKNSLKKLLNMKLSICFMKSDFQKFWSKSSQLGDTTS
GSLAGGERKGSESDWHGFLVEEKRNKPIKAYSADNYSLESQKKRKKSRGQTSAANGPRAE
SLDEQMLSRESSSQAPCKSVISGCAPEYENIRHYEEIPEYENLPFIMTVGKTPELEWQNS
SSVEDTDANVYEVEEPYEAPDGQLQLAPRHQHSSSGASQEGPNDLDLHLSDLPSDEEEVI
NSSDEDNVSSASSKGEPDLLEDKQGEDTGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFR
DAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQRIADIFVK
KGPYLKMYSTYIKEFDKNIALLDEQYKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQR
IPQYRLLLTDYLKNLLEDAGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLN
GHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGM
KVRKPTQEAYQNELKIESVERSFILSASSAPERDEWLEAISRSIEEYAKKRITFCPSRSL
DEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVCQACSSN
KYGLDYLKNQPARVCEHCFQELQKLDHQHSPNIGSPGYHQSPSSTLSSVLHSIPSGRKQK
KIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIEAFQEGTIL
Download sequence
Identical sequences ENSTTRP00000004802 ENSTTRP00000004802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]