SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004812 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004812
Domain Number 1 Region: 15-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-26
Family DEP domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004812
Domain Number - Region: 398-418
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00185
Family Regulator of G-protein signaling, RGS 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004812   Gene: ENSTTRG00000005111   Transcript: ENSTTRT00000005102
Sequence length 459
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2529:35759:45412:-1 gene:ENSTTRG00000005111 transcript:ENSTTRT00000005102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPASHGGLRRAQRPHLSMERMVVSMQDPDQGVKMRSQRLLITVIPHAVTGNDIMEWLIHK
YCITEEEALHLGTLLVRHGYLYPLRDPCHLELRLDETPYRFQTPYFWMSTLWPAAELDYA
IYLAKKNIRKRGGLFDHEKEHYDQLHRKISHTWDLVVMQAREQLWAAKQRRKGDRLVIAC
QEQTYWLVNRPPPGVPSVLEQGPERNSCTAGRVQMXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSYPRFLKSDLYKDLLAEAVVP
PETKRRVFPFMRKPRHSSPSPALLPASASREPSGGDGEA
Download sequence
Identical sequences ENSTTRP00000004812 ENSTTRP00000004812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]