SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004827 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004827
Domain Number 1 Region: 692-992
Classification Level Classification E-value
Superfamily BEACH domain 6.54e-126
Family BEACH domain 0.00000000994
Further Details:      
 
Domain Number 2 Region: 1113-1363
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.68e-29
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 596-691
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-23
Family PreBEACH PH-like domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004827   Gene: ENSTTRG00000005099   Transcript: ENSTTRT00000005119
Sequence length 1400
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1727:19597:88929:1 gene:ENSTTRG00000005099 transcript:ENSTTRT00000005119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDNGKNISAEDMKRNSDEKTDEEKISSFASAHVSSDHWSLEDRHSLDSNTPLFQEDSLM
GELSFKSENRGEFWHNNPSHLSLDLSGIDSCELSDSGSQMPDSLPSTPSPIESTKSFSVQ
SDKESSITNDVGFSDDFPLLENQERCEEELIQLLTNILNCVMCKGLEKSDDDTWIERGQV
FSALTKPGISSELLRPSHEIKLILLQKMLEWAVTENREAKFNPVTAENAFRLMLIIQDFL
QSEGLVNSNMWTEKLLEDMMLLFDSLSVWYSESPVWVKLSQIQIQMLLGFIGRGNLQVCA
VASAKLNTLLQTKVIENQDEACYILGKLEHVLSESIKEQTEIYSFLIPLVRTLVSKIYEL
LFMNLHLPSLPFTNGSSSFFEDFQEYCSSNEWQVYIEKYIVPYMKQYETHAFYDGHESMA
LYWKDCYEALMVNMHKRDREGGESKLKFQXXXXXXXXXXXXXXXXXXXXXXXXXSSPQLA
TLRRWKAIKLYLTCERGPWAERKQNPLHWKLANVENYSRMRLKLVPNYNFKTHDEASALR
DNLGIQHLQPSSDSLLLEVVKQVKVSDMEEDKLDLPEEEITARVNINEKEEQDQKEKLVL
LEDCELITIIAIIPGRLEITTQHIYFYDGSIEKEDGVGFDFKWPHSQVREILRRYNLRRS
ALEIFHVDQSNYFLNFKKEVRNKVYSRLLSLHSPNSYGTRSPQELFKASGLTQKWVNREI
SNFDYLIQLNTMAGRTYNDLAQYPVFPWILQDYTSDELDLNNPSVFRDLSKPIGVVNDKN
AKAMREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRTEPFTTLHIQLQSGRFDCADR
QFHSIPATWQALMDNPYDVKELIPEFFYFPEFLENQNQFNLGRLQVSRELVNDVILPKWA
KSAEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDA
LTDEKERKALEGMINNFGQTPCQLLKEPHPSRLSAEEAVQKQTKTDTSTFNLFQYLPELK
SFFIEGISDGIPLIKAIVPKNQSRSFISQGSPELLITVSMNYVIGTHGWLPYDRNISNYF
TFIRDQTVTNPKTQRSMNGPFAPGLEITSKLFIVSHDAKLLFSAGHWDNSIQVMSLTKGK
IVSHNIRHMDIVTCLATDYCGIHLISGSRDTTCMVWQITQQGGVPVGLASKPFQILYGHT
DEVLSVGISTELDMAVSGSRDGTVIIHTIQKGQYMRTLRPPCESSLLLTIPNLAISWEGH
IVIYSSIEESTTLKDKNALHLFSVNGKYLRSQVLKEQVSDICVIGEHIVTGSLQGFLSIR
DLHSLNLSINPLAMRSPIHCVYVTKEYSHILVGLEDGKLIVVGVGKPAEMRSGLSRLWGS
SKRLSQISAGETEYNPQDSK
Download sequence
Identical sequences ENSTTRP00000004827 ENSTTRP00000004827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]