SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004850 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004850
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000131
Family Calcium ATPase, transduction domain A 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004850   Gene: ENSTTRG00000005154   Transcript: ENSTTRT00000005144
Sequence length 105
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3396:236124:238525:1 gene:ENSTTRG00000005154 transcript:ENSTTRT00000005144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQVGDIIKLENNQVVTADILLLSSSEPYSLTYIETAELDGETNLKVKQAISVTSEMED
NLKLLSAFDGEVRCESPNNRLDRFTGILIYKGKNYVLDHDRLILR
Download sequence
Identical sequences ENSTTRP00000004850 ENSTTRP00000004850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]