SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004881 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004881
Domain Number 1 Region: 311-413,483-617
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.83e-27
Family N-type ATP pyrophosphatases 0.02
Further Details:      
 
Domain Number 2 Region: 1-180
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000000000000772
Family Class II glutamine amidotransferases 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004881   Gene: ENSTTRG00000005179   Transcript: ENSTTRT00000005176
Sequence length 638
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1531:146461:157305:1 gene:ENSTTRG00000005179 transcript:ENSTTRT00000005176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGICCAVLSEHSQRLKELLCNLKRRGNSSKQLLKSNINYQCLFSGHVLHLRGVLTAQPV
EDERGNVFLWNGEVFSGIKVEAEENDTQIMFNYLSSCKNESDILSLFSKVQGPWSFIYYQ
ASSHSLWFGRDFFGRRSLLWHFSSLGKSFCLSSIGAQTSGVANQWQEVPASGIFRIDLKS
TSISKSVVLKLYPWKYNSREDVIKECVNSLTQISADLPTFVSVAANEAKLYLKEPVVPLN
MILPQAAFEIHCTSISSVPPSRETLQVFLTDGHMKEVVQQFIDVLSIAVKRRVLCLPRDE
NLTQSEVLNTSNRKANVAILFSGGIDSMVIAALADRHIPLDEPIDLLNVAFMTKEKTIPA
GFNKKGRKEKNNCEKRSEESSTNVTAAAAANPGEQFNVPDRITGRAGLKELQAASPSRIW
NFVEINVSLEELQRLRRTRISHLIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVVLTGIGADEQLAGYSRHRVRFQTHGLEGLNKEIEMELGRISSRNLGRDDRVIGDHG
KEARFPFLDENVVSFLNSLPVWEKANLTLSRGIGEKLILRLAAVELGLTTSALLPKRAMQ
FGSRIAKLEKNNEKASDKCGRLRVISLENLSIEKEIKT
Download sequence
Identical sequences ENSTTRP00000004881 ENSTTRP00000004881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]