SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004951 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004951
Domain Number 1 Region: 69-373
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000148
Further Details:      
 
Domain Number 2 Region: 430-557
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.42e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000001
Further Details:      
 
Domain Number 3 Region: 1-70
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000202
Family Thioltransferase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004951   Gene: ENSTTRG00000005249   Transcript: ENSTTRT00000005251
Sequence length 560
Comment pep:novel genescaffold:turTru1:GeneScaffold_238:108065:137072:-1 gene:ENSTTRG00000005249 transcript:ENSTTRT00000005251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKELFSSLGVDCNILELDQVDDGASVQEVLSEITNQRTVPNIFVNKVHVGGCDRTFQAHQ
SGLLQKLLQEDPAYDYDLIVIGGGSGGLSCAQEAAALGRRVMVLDLVVPSPQGTSWGLGG
TCVNVGCIPKQLMHQAALLGQALTDSRRFGWECAQQVKHNWETMTEAIQKHVGSLNWSYR
RALREKAVAYVNSYGEFVEHHKIKATDGKGQETYYTAAKFVIATGERPRYLGIQGDKEYC
ITSDDLFSLPYCPGATLVVGASSVALECAGFLAGLGLEVTVMVRSQLLRGFDQEMAEKVA
SSMQQLGVRFLRKFVPVEVQQLERGSPGKLKVVAKSTEGTEMIEGLYNTVLLAIGRDSCT
KKIGLEKIGVKVNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCDYINAPTVVFTPLEYGCCGYAEEKAVEVYRKENLEVYHTLFWPLEWTVACRD
SNTCYAKIICSKFDNDRVIGFHVLGPKAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCAQ
VFTTLEITKSSGLDIMQKGC
Download sequence
Identical sequences ENSTTRP00000004951 ENSTTRP00000004951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]