SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005022 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005022
Domain Number 1 Region: 830-938
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-23
Family DBL homology domain (DH-domain) 0.00075
Further Details:      
 
Domain Number 2 Region: 650-701
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000118
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005022
Domain Number - Region: 135-218
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0016
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005022   Gene: ENSTTRG00000005332   Transcript: ENSTTRT00000005327
Sequence length 939
Comment pep:novel genescaffold:turTru1:GeneScaffold_3563:42444:217673:1 gene:ENSTTRG00000005332 transcript:ENSTTRT00000005327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNCSEVPLYGQMTVYAKFGKNVYLPKDAEFYFIYNGSHQRHIVIAERTEDNVLQSSVP
GHRLQETVTVSVCLCSEGYSPVTMGSDSVTYVDNMACRLARLLVTQADRLTASSHQTLLT
PFALTAGALPALDEELVLALTHLELPLGWTVLGNSSLEVSLHRESLLHLAVRWGLAKLSQ
FLLCLPGGVQALALPNEEGATPLDLALHGGCSKLFEDITNFQGRRSPGFSRVQLSEDASL
RYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLLKALEEQEARSEEKSDMPSSTA
ETEEEIKNSVSSRSSPGEENVKHVKSPVVQLNEHEDQDSLYLXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVGDLDINYINIEGITENTCLESMGSTPGPQNSKPILP
TETSAGTYPPNENTEVPSHTETQPSLMSPSSSYASSLNLSFGLHGFEKEQSHLKKRSSSL
DALDADSEGEGHSERSRICHTPVSQSSSRTGIPSGDELDSFETNTEPDFNISRTESLSLS
SSLQLKESLFSGVRSRSYSCSSPKISLGKTRLIRDFTVCNSAEEQRAYSLPEPPREKRIQ
EEEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKGKDAKDKEKLSRHQFVPGT
FSGTLQCLVCDKTLLGKESFQCSNCNANVHKGCKDAASPCTKKFQVKYNKNKPQTILGNS
SFRDVPPPGLSLHPSSSMPVGLPTGRKEAAGQVHPLSRSVPGITLESFRRSGASLESESD
GSTWKSRSQSDELFQPMGSPPSTDSFLMEDVVDSSLWSDLSSDAQGFEAESWSLVVDPSF
CSRQEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDE
LLEIHRHFFYSMKERRQESCIGNDRNFVINRIGDILVQQ
Download sequence
Identical sequences ENSTTRP00000005022 ENSTTRP00000005022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]