SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005040 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005040
Domain Number 1 Region: 45-429
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.16e-95
Family L-arabinose binding protein-like 0.00000000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005040   Gene: ENSTTRG00000005354   Transcript: ENSTTRT00000005348
Sequence length 532
Comment pep:known_by_projection scaffold:turTru1:scaffold_116172:37610:101529:-1 gene:ENSTTRG00000005354 transcript:ENSTTRT00000005348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLLVLTFSACVLLGWALLAGCTGGGVGGGAGPGGGRREREALPPQKIEVLVLLPQDDS
YLFSLARVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAAR
GAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFRHKDTEYSHLTRVAPAYAKM
GEMMLALFRHHQWSRAVLVYSDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDLDV
DDIVRYIQASERVVIMCASSDTIRGIMLAAHRHGMTSGDYAFFNIELFNSSSYGDGSWKR
GDKHDFEAKQAYSSLQTITLLRTVKPEFEKFSMEVKSSVEKQGLSEEDYVNMFVEGFHDA
ILLYVLALHEVLRAGYSKDGGKIIQQTWTFEGIAGQVSIDANGDRYGDFSVIAMTDTEAG
TQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDETRMVEHTNSSPCKASGLKESAVTRIV
VGDLLRAGLLMAFYFRKKYRITIERRNQQEESNVGKHRELREDSIRSHFSVA
Download sequence
Identical sequences ENSTTRP00000005040 ENSTTRP00000005040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]