SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005085 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005085
Domain Number 1 Region: 47-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000157
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 2 Region: 135-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000108
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005085   Gene: ENSTTRG00000005399   Transcript: ENSTTRT00000005393
Sequence length 329
Comment pep:known_by_projection scaffold:turTru1:scaffold_110856:148492:162814:-1 gene:ENSTTRG00000005399 transcript:ENSTTRT00000005393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSFQLLASLMCIILMGSFVRTKRDTTRNLLNTELHSAPAQRWSMKLPAEVSAAAGEAA
VLPCTFTHPHRHYDGPLTAIWRAGEPYTGPQVFRCAAARSSELCQTALSLHGRFRLLGNP
RRNDLSLRVERLALADDGRYFCRVEFAGDVHERYESRHGVRLRVTAAPRIVNISVLPGPA
HTFHALCTAEGEPPPTLTWSGPALGNGSASVPSPGQDHGHQVTAELPALAHDGRYTCAAS
NSLGRTEASVYLFRFHGASRASAIALPLGALGLKVLLLLGVLAARAAACRRLEYPVTQDA
SPRPQAQESNYENLGQMSPQGPPAAMCSP
Download sequence
Identical sequences ENSTTRP00000005085 ENSTTRP00000005085 XP_004323687.2.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]