SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005130 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005130
Domain Number 1 Region: 65-295
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.41e-67
Family DNA/RNA non-specific endonuclease 0.0000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005130   Gene: ENSTTRG00000005449   Transcript: ENSTTRT00000005439
Sequence length 368
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2758:255190:275990:1 gene:ENSTTRG00000005449 transcript:ENSTTRT00000005439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVTAFASRFRGSRRFLSGFVAGAVAGAVGTGLTVVQFLRSQDAEPALAVREPDGSSERA
LLEQFGFPLTGTETRCYTNHALSYDQSKRVPRWVLEHISKSKITGDADRKHCKFKPDPNI
PPTFSAFNEDYVGSGWSRGHMAPAGDNKFSSKAMAETFYLSNIVPQNFDNNAGYWNRMEM
YCRELTERFEDVWVVSGPLTLPQTGSNGRKTVSYQVIGEDNVAVPSHLYKVILARRNPRS
AEPLALGAFVVPNKAIGFQPQLSEFQVSLQELEKLSGLVFFPHLDRTSDIKNICSVDTCK
LLDFREFTLYLSTRKIEGARSVLRLEKVMENLQNAGIEPDEEFMTRYKKKLEELKAQEQS
GVLERKSS
Download sequence
Identical sequences ENSTTRP00000005130 ENSTTRP00000005130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]