SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005169 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005169
Domain Number 1 Region: 526-636
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000102
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 289-347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000038
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 702-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 642-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000183
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 770-835
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000393
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 463-528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005169
Domain Number - Region: 377-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00144
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005169   Gene: ENSTTRG00000005479   Transcript: ENSTTRT00000005478
Sequence length 909
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3331:144282:162118:-1 gene:ENSTTRG00000005479 transcript:ENSTTRT00000005478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEALPEPGNETPTVASEALAELLHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKGGRGAGPTAP
ELLTPPPGTTAPPLPGPASPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGHVESPDLGSAASRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSREEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPAWSSEPPSCMXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXWVIEAAEGRRLHHFERVSLDEDNDRLMVRSGGSPLSPVIYDSD
MDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEY
RPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSP
DWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQP
RRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGD
LIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACRKIMTCADPGEITNGHRTTSDA
GFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGY
QTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVSQTTDPSRQLE
GGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAG
DTREYEVSI
Download sequence
Identical sequences ENSTTRP00000005169 ENSTTRP00000005169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]