SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005270 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005270
Domain Number 1 Region: 43-198,225-378
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.52e-50
Family (Glycosyl)asparaginase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005270   Gene: ENSTTRG00000005584   Transcript: ENSTTRT00000005586
Sequence length 412
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_419:84651:295838:-1 gene:ENSTTRG00000005584 transcript:ENSTTRT00000005586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMEKGMSSGEGLPSRSSQVSAVKITAKELETKQPHKEKRGGFVLVHAGAGYHSESKAKE
YKHVCKRACQKXXXXXXXXXXXXXXXXXXXXXXXDSPFTNAGMGSNLNLLGEIECDASIM
DGKSLNFGAVGALSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIP
SCPPNIMTTRFSLAAKRNKRKLELAEVTDFIQLKKRSEKENDSGTLDTVGAVVVDHEGNV
AAAVSSGGLALKHPGRVGQXXXXXXXXXXXXXXXXXXXXXXXXXXXCGEHLVRTILAREC
SHALQAEDAHALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSAEPNSSPNKQTLLVE
FLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGVCRLESPVS
Download sequence
Identical sequences ENSTTRP00000005270 ENSTTRP00000005270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]