SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005313 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000005313
Domain Number - Region: 149-220
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0643
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005313   Gene: ENSTTRG00000005630   Transcript: ENSTTRT00000005630
Sequence length 699
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_486:547343:559825:-1 gene:ENSTTRG00000005630 transcript:ENSTTRT00000005630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLKKKSGNMKRLSPAPQLGPSSDRHTSYYSESVVRESYFGSPPRNSILDDQLRGDPFWSE
DLRVRRRDTGGTESSKVNGLPENKLSEDFLGSSSGYSSEDDYVEDSGGGGTRVRTTGVSS
SSAGYSETDQQGSGSRLRNAVSRAGSLFWMVFTSPGRLFGLLYWWIGTTWYRLTTAASLL
DVFVLTRRFSSLKTFLWFLLLLLLLTGLTYGAWYCYPFGLQTFHPAVASWWASKGSSGQR
AVWGSRDSSPHFQAEQRILSRVHSLERRLEALAAEFSSSWQKEAMRLERLELRQGAGGQG
GSGSLSHEDTLALLEGLVSRREAALKEDFRRDTAAQIQEELVTLRAEHQQDSEDLFKKIV
QASQESEARLQELKSEWQRMTQESFRESSMKELGRLGVQLEGLRQELAALTLKQSSVEDQ
VGLLPQQLQAVRDDVESQFPAWVSQFLLRGGGSRTGLLQREEVQAQLQELESKILARVAE
MQGKSAREAVASLGLTLQKEGVIGVTEEQVHRIVNQALKRYSEDRIGMVDYALESGGASV
ISTRCSETYETKTALLSLFGIPLWYQSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSAR
IRPTAVTLEHVPKSLSPNSTISSAPKDFAVFGFDEDLQQEGMLLGQFTYDQDGEPIQTFY
FQGPKMAAYQVVELRILTNWGHPEYTCIYRFRVHGEPTH
Download sequence
Identical sequences ENSTTRP00000005313 ENSTTRP00000005313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]