SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005316 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005316
Domain Number 1 Region: 102-152
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00000000375
Family C-type lysozyme 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005316
Domain Number - Region: 22-46
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0563
Family C-type lysozyme 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005316   Gene: ENSTTRG00000005633   Transcript: ENSTTRT00000005633
Sequence length 160
Comment pep:novel genescaffold:turTru1:GeneScaffold_2689:18640:21956:1 gene:ENSTTRG00000005633 transcript:ENSTTRT00000005633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAWDTMVVTLAMLMPATVDAKIFQRCDLAMKLEEVGLNGFKGYTIGGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNRHILDDIMCAKQIVS
SQNSMNTWDSWSQHYSGHDLSEWLKGCHMYAKPYTTEINS
Download sequence
Identical sequences ENSTTRP00000005316 ENSTTRP00000005316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]