SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005329 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005329
Domain Number 1 Region: 11-234
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.95e-96
Family Proteasome subunits 0.00000000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005329   Gene: ENSTTRG00000005649   Transcript: ENSTTRT00000005646
Sequence length 234
Comment pep:known_by_projection scaffold:turTru1:scaffold_104667:8202:18446:1 gene:ENSTTRG00000005649 transcript:ENSTTRT00000005646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Download sequence
Identical sequences A0A024RA52 A0A091CRZ5 A0A096MXE0 A0A0D9RS97 A0A1A6HP35 A0A1D5RAS1 A0A1S3AHU7 A0A1S3GHW7 A0A1U7QGL6 A0A1U7UXG5 A0A250YD07 A0A286Y3W0 A0A2K5F9W7 A0A2K5JKW8 A0A2K5LCP2 A0A2K5R3Q1 A0A2K5YCT5 A0A2K6DWX7 A0A2K6GKE1 A0A2K6L546 A0A2K6PDA2 A0A2K6SFG9 F7IE60 G1LS94 G1QSE5 G1T2L1 G3HSF3 G3QUJ3 G5BJZ6 G8F2T1 H0XG59 H2PMA4 H2R5C6 I3LAB6 I3MKT0 L5JQS9 L5MBS4 M3XAA2 M3Z372 P25787 Q3T0Y5 W5Q7C7 W6FFJ6
ENSPPYP00000019740 ENSP00000223321 ENSP00000455744 ENSETEP00000012841 ENSETEP00000012841 ENSNLEP00000003863 ENSAMEP00000009932 ENSCPOP00000011823 10141.ENSCPOP00000011823 9361.ENSDNOP00000009229 9544.ENSMMUP00000029542 9598.ENSPTRP00000048032 9600.ENSPPYP00000019740 9606.ENSP00000223321 9615.ENSCAFP00000005235 9986.ENSOCUP00000010402 ENSP00000223321 ENSP00000455744 ENSTSYP00000013133 ENSP00000223321 ENSP00000455744 ENSTTRP00000005329 ENSPTRP00000048032 ENSSSCP00000020984 ENSTTRP00000005329 ENSMPUP00000018034 ENSMPUP00000018034 ENSCJAP00000014349 NP_001029834.1.59421 NP_001029834.1.76553 NP_001253810.1.72884 NP_001277514.1.5354 NP_002778.1.87134 NP_002778.1.92137 XP_002713818.1.1745 XP_002751405.1.60252 XP_002818066.1.23681 XP_002923446.1.58354 XP_003268869.1.23891 XP_003360255.2.46622 XP_003470144.1.53824 XP_003506459.1.69978 XP_003797596.1.62490 XP_003808734.1.60992 XP_003930812.1.74449 XP_003982680.1.62641 XP_004008046.1.66739 XP_004045389.1.27298 XP_004263367.1.21590 XP_004317033.1.83887 XP_004384017.1.4749 XP_004438367.1.5094 XP_004449147.1.11602 XP_004582408.1.84141 XP_004676705.1.23501 XP_004708090.1.18182 XP_004739419.1.14098 XP_004840303.1.39548 XP_005071854.1.91757 XP_005319276.1.77405 XP_005397772.1.28644 XP_005679400.1.57651 XP_005957771.1.78601 XP_006046381.1.26621 XP_006192145.1.101512 XP_006198596.1.17985 XP_006732669.1.47382 XP_006757293.1.95426 XP_006832171.1.41390 XP_006900259.1.29581 XP_006925408.1.64745 XP_007125736.1.24612 XP_007187792.1.59432 XP_007468255.1.90284 XP_007535156.1.11023 XP_007622626.1.28591 XP_007939426.1.48129 XP_007979717.1.81039 XP_008070586.1.4292 XP_008701721.1.72690 XP_008834501.1.79516 XP_010379877.1.97406 XP_010609155.1.5607 XP_010827376.1.44457 XP_010967858.1.22495 XP_010982293.1.51371 XP_011375016.1.92234 XP_011760692.1.29376 XP_011814188.1.43180 XP_011850507.1.47321 XP_011968457.1.54773 XP_012328860.1.9421 XP_012502407.1.63892 XP_012596424.1.48125 XP_012888473.1.60039 XP_014930775.1.86478 XP_015974438.1.101085 XP_016068007.1.3490 XP_017369484.1.71028 XP_017518169.1.32401 XP_017718598.1.44346 XP_019306622.1.44245 XP_019814525.1.53367 XP_020035015.1.5219 XP_021559428.1.83697 XP_528026.2.37143 XP_533078.4.84170 Hs4506181___KOG0181 ENSOCUP00000010402 ENSOGAP00000015044 ENSCPOP00000011823 ENSPTRP00000048032 ENSSSCP00000020984 ENSBTAP00000001309 ENSSTOP00000011947 ENSPANP00000004553 ENSOARP00000018619 ENSTSYP00000013133 ENSDNOP00000009229 ENSPPYP00000019740 ENSMMUP00000029542 5a0q_B 5a0q_P 5gjq_C 5gjq_i 5gjr_C 5gjr_i 5l4g_B 5l4g_O 5le5_A 5le5_O 5lex_A 5lex_O 5ley_A 5ley_O 5lez_A 5lez_O 5lf0_A 5lf0_O 5lf1_A 5lf1_O 5lf3_A 5lf3_O 5lf4_A 5lf4_O 5lf6_A 5lf6_O 5lf7_A 5lf7_O 5ln3_B 5m32_A 5m32_O 6avo_P 6avo_b ENSCJAP00000014349 002045276|e5ln3B1|210.1.1.3|B:1-234 ENSAMEP00000009932 ENSMMUP00000029542 ENSBTAP00000001309 ENSFCAP00000023555 ENSGGOP00000006397 HGL_H00000409815 ENSGGOP00000006397 gi|4506181|ref|NP_002778.1| ENSDNOP00000009229 ENSOGAP00000015044 ENSOCUP00000010402 ENSNLEP00000003863 ENSSTOP00000011947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]