SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005427 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005427
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.82e-52
Family LplA-like 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005427   Gene: ENSTTRG00000005752   Transcript: ENSTTRT00000005746
Sequence length 225
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2849:10729:12595:-1 gene:ENSTTRG00000005752 transcript:ENSTTRT00000005746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPAVQLLRLSQVPYAELLALQERWLRRLQAETGTEAGALLLCEPAGPVYTAGLRGGLT
SEEATRLRALGADVRAIGRGGLATFHGPGQLLCHPVLDLRPLGLRLRAHVAALEACAVRL
CELQGLPGARARPPPYTGVWLGERKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCG
LVGTGVTSLSKELQRHVTVDEVIPHFLEAFKETYKCTLISEDSPS
Download sequence
Identical sequences ENSTTRP00000005427 XP_004310600.1.83887 ENSTTRP00000005427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]