SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005441 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005441
Domain Number 1 Region: 1764-1907
Classification Level Classification E-value
Superfamily C-type lectin-like 8.57e-43
Family C-type lectin domain 0.00000034
Further Details:      
 
Domain Number 2 Region: 456-564
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-43
Family Link domain 0.0014
Further Details:      
 
Domain Number 3 Region: 125-236
Classification Level Classification E-value
Superfamily C-type lectin-like 5.02e-40
Family Link domain 0.0016
Further Details:      
 
Domain Number 4 Region: 564-681
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-31
Family Link domain 0.0043
Further Details:      
 
Domain Number 5 Region: 237-331
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-28
Family Link domain 0.0025
Further Details:      
 
Domain Number 6 Region: 9-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000142
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 7 Region: 1908-1968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005441   Gene: ENSTTRG00000005757   Transcript: ENSTTRT00000005760
Sequence length 1993
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2134:37062:71613:1 gene:ENSTTRG00000005757 transcript:ENSTTRT00000005760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDNSLSVSIPEPSPLRVLLGSSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSCISKEKEL
VLLVATEGQVRVNSAYRDRVTLPNYPAIPSDATLEVQNLRSNDSGIYRCEVMHGIEDSKA
TVEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWL
ADQTVRYPIHTPREACYGDKDEFPGVRTYGIRDTNETYDVYCFAEEMEGEVFYATSPEKF
TFQEAANECRRLGARLATTGQLYLAWQSGMDMCSAGWLADRSVRYPISKARPNCGGNLLG
VRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEDFFGVGGEEDITIQTVTWPDVELPL
PRNITEGEARGSVILTVKPVFDITPTALEPEEPLTFAPEVGATAFSEAENRTGEATRPWA
FPEESTPGLGAPTAFTSEDLVVQVTAVPGQPRLPGGVVFHYRPGSSRYSLTFEEAQQACL
RTGAVIASPEQLQAAYEAGYEQCDAGWLQDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVR
PPSETYDVYCYVDRLDGEVFFATSPEQFTFQEAQEFCETQNATLATTGQLYAAWSQGLDK
CYAGWLSDGSLRYPIVTPRPACGGDKPGVRTVYLYPNQTGLLDPLSRHHAFCFRGIPAAP
SPGEEEGRTPTERPEVEAWITTEVGPSVAAVPVGEETTAIPDFTTEPENQTEWEPAYTPA
GTSPLPGVPPTWLPTSTATEESTEGPSATEVPSASEEPLPSEKPLPSEEPFPSEEPFPSE
EPFPSEKPFPSEELFPSEEPSTLSAPVPSRTELPGSGEVSGVPEVSGDFTGSGEISGHLD
SSGQPSGEIASGLPSEDLDFSGLTSTVGSGLPVESGLASGDEDRITWTTSPEVDRLPSGG
EVPEGSVSGVGDLSGLPSVGEDHLETSASGVGDLSGLPSGREDLETSVSGVEDLSGLPSG
EGPETSASGIEDLSRLPSGEGPEASASGVEDLSGLPSGGEGLETSVSGVEDLSGLPSVGE
DHLETSASGVGDLSGLPSGRESLEISASGAEDLSGLTSGKEDLIGSASGVLDLGRIPSGT
LGSGQAPEAGGLPSGFSGEYSGVDLGSGPSSGLPDFSGLPSGFPTVSLVDTTLVEVVTAT
TAGELEGRGTIGISGAGETSGLPFSELDISGGASRLSSGAELSGQASGTPDISGETSGLF
GVSGQPSGFPDISGGTSGVTELSGLSSGQPEISGEASGVLSGIGPPFGITDMSGETSGIP
DLSGQPSGLPGFSGTTSGIPDLVSSTVSGSGESSGVTFVDTSLVEVTPATFKEEEGLGSV
ELSGLPSGEADLSGTSGIVDVSGLSSGVIDSSGFTPQPPEFSGLPSRVAEVSGESSGAES
GSSQPSGAYDGRGLPSGFSTVSLVDRTLVESVTQVPTAQEAGEGPSGILELSGAPSGAPD
MSGGHSGLLDLSGLQSGLVEPSGEPSSTPYFSGDFSGTTDVSGESSAPTSTSGEASGLPE
VTLIISEFVEGVTEPTVSQELGQRPPVTYTPQRFESSGETSASGDAPRFPGSGVEASSVP
ESSSETSAYPEAEVGASAVPEASGGTSRSPDLSGTTSTFHEADLEGASGLGVTGSTSAFQ
EGPREGSAAPEVSGESTTTYDVGTEASGSPSATPMASGDRTEISRDLSGHTSGLDVVIST
TILESKWTQQTQSPAEAHLEMESSSPEHSGEDTQTAKTPTSATDASIPNSPGGTDESEAT
MADPTTCAKEPCGAGTCQETEGHIICLCPPGHTGKHDIDQKLCEKGWTKFQGHCYRHFPD
RATWVDAEGQCRKQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDKTIEGDFRWSDGHSLQ
FENWRPNQPDNFFATGEDCVVMIWHEKGEWNDVPCNYQLPFTCKKGTVACGEPPVVEHAR
IFGQKKDRYEINSLVRYQCTEGFVQRHVPTIRCQPSGHWEDPRITCTDPSTYKRRLQKRS
SRPLRRSRPSTAH
Download sequence
Identical sequences ENSTTRP00000005441 ENSTTRP00000005441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]