SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005461 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005461
Domain Number 1 Region: 106-420
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.63e-71
Family Arginine methyltransferase 0.00000301
Further Details:      
 
Domain Number 2 Region: 27-85
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-16
Family SH3-domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005461   Gene: ENSTTRG00000005777   Transcript: ENSTTRT00000005780
Sequence length 434
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2202:10514:52035:1 gene:ENSTTRG00000005777 transcript:ENSTTRT00000005780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGDCPRSELQEGEDPVVQGEEGNLQGTVHPEEFVAIADYSATDETQLSFSRGEKILI
LRQTTADWWWGERAGCCGYIPANHLGKHLEDWGPEDSWQDEEYFGSYGTLKLHLEMLADQ
PRTTKYHNVILQNKESLKDKVILDVGCGTGIISLFCAHYAQPRAVYAVEASEMAQHTGQL
VMQNGFADIITVFQQKVEDVLLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGV
IWPTTAALHLVPCSADRDYRSKVLFWDNAYEFDLSALKSLAIKEFFSKPKYNHILKPEDC
LSEPCTILQLDMRTVQIADLEMMKGELHFDIKKAGTLHGFTAWFSVRFQNLEEDEPQLVL
STGPLHPTTHWKQVLFMMDEPVSVLAGDVVTGSVVLQRNPVWRRHMSVTLSWSVTSRQDP
GSQKVGEKVFPIWR
Download sequence
Identical sequences ENSTTRP00000005461 ENSTTRP00000005461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]