SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005494 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000005494
Domain Number - Region: 253-342
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000875
Family Gamma-glutamyltranspeptidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005494   Gene: ENSTTRG00000005824   Transcript: ENSTTRT00000005813
Sequence length 350
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2120:68767:78469:-1 gene:ENSTTRG00000005824 transcript:ENSTTRT00000005813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYTGLQRL
SKEGPAGKSCACRRCMGDAGASEWFDSHFNSNISPVWTRENMDLPPEVQRWWMMLQPQFK
SHNTNEVLEKLFQIVPGENPYRFRDPRRCRRCAVVGNSGNLRGSGYGPDVDGHNFIMRMN
QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLLWIASALSTGQIRFTY
APVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Download sequence
Identical sequences XP_004273299.1.21590 ENSTTRP00000005494 ENSTTRP00000005494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]