SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005562 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005562
Domain Number 1 Region: 455-744
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-51
Family Eukaryotic proteases 0.0000232
Further Details:      
 
Domain Number 2 Region: 188-455
Classification Level Classification E-value
Superfamily vWA-like 3.76e-49
Family Integrin A (or I) domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 84-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000764
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 5 Region: 23-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005562   Gene: ENSTTRG00000005868   Transcript: ENSTTRT00000005882
Sequence length 751
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3469:12879:24861:1 gene:ENSTTRG00000005868 transcript:ENSTTRT00000005882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMAVLCLLPLYPGLATTATSCPQNVNISRGTFTLSNGWAPGSILTYSCPLGFYPYPV
ATSLCKSNGRWHFPRSTQQTKAVCKPVRCPAPVTFENGVYTPRLGSHPVGGNLSFECEDG
FTLRGSPVRHCRPNGMWDGETAVCDNGASHCPNPGIAAGAVRTGSRFGLGDKVSYRCSSN
LVLTGSVERECQDDGVWSGMEPICRQPYSYDFPEDVAPALGISLSHLLGATNPTQKKQQN
VGRKIQIQRSGHLNLYVLLDASQSVEEEDFEIFKKSASHLVDRIFSFEIKVSVAIITFAS
KPKVIMSVLDSKSKDVTEVAHSLENAHYKDHENGTGTNIYEALNSVYIMMNNQMRRLSMN
TAAWQEIRHAIILLTDGKSNMGGSPKVAVDNIKEVLNINQKRKDYLDIYAIGVGNLDVDW
RELNELGSKKDGERHAFILKDVKALSQVFEHMLDVSQLTDTICGVGNMSANASAQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCLHNAEARPLWRVSVGDPNFQWGKEFQVEKAVI
SSGFNVFAKKNHGIPEFYGDDIALLKLAQKVKXXXXXXPICLPCTVGANLALRRLPGSTC
RDHESELLNKLSIPAHFVALNGNKLNVNLKTGSEWANCVKVVSQDKTTFPNLTDVREVVT
DQFLCSGMQGDDNPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCGSSDKNSRKSAPRGR
VPPPRDFHINLFRVQPWLRQHLEGVLNFLPL
Download sequence
Identical sequences ENSTTRP00000005562 ENSTTRP00000005562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]