SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005580 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005580
Domain Number 1 Region: 77-205
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-44
Family Regulator of G-protein signaling, RGS 0.000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005580   Gene: ENSTTRG00000005909   Transcript: ENSTTRT00000005900
Sequence length 216
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3442:24793:26926:-1 gene:ENSTTRG00000005909 transcript:ENSTTRT00000005900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTPPEAEKQHTGPEEGDQPPSMSSRDAAPPAPPRRNPCCLCWCCCCSCSWNERRRAWRA
SRESRLQPLPSCEACATPSPEEVRSWAQSFDKLMHSPAGRSVFREFLRTEYSEENMLFWL
ACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGVNKKMQEPSAHTFDDAQ
LQIYTLMHRDSYPRFLSSPAYRALLLRGRSTSSSEA
Download sequence
Identical sequences ENSTTRP00000005580 ENSTTRP00000005580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]