SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005589 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005589
Domain Number 1 Region: 202-471
Classification Level Classification E-value
Superfamily vWA-like 3.26e-57
Family Integrin A (or I) domain 0.0000000208
Further Details:      
 
Domain Number 2 Region: 474-759
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.75e-57
Family Eukaryotic proteases 0.00000000086
Further Details:      
 
Domain Number 3 Region: 98-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000364
Family Complement control module/SCR domain 0.0000373
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.000038
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000556
Family Complement control module/SCR domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005589   Gene: ENSTTRG00000005903   Transcript: ENSTTRT00000005909
Sequence length 765
Comment pep:novel genescaffold:turTru1:GeneScaffold_3469:25670:31623:1 gene:ENSTTRG00000005903 transcript:ENSTTRT00000005909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRSPQLCLVPLILGLLSGGVSMTPLPEAGPQSPCSLEGIEIKGGSFRLLKAGQSLEY
LCPSGFYPYPVQIRTCRSTGSWSTLQTQDKKIVKRAECKAIRCPRPQDFENGEYWPRAPY
YNLSDEISFHCYDGYNLRGSANRTCQATGRWDGETAICDDGAGYCLNPGIPIGTRKVGSQ
YRLEDTVTYYCSRGLTLRGSKQRTCQEGGSWSGTEPSCHDSFMYDTPAEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIILDPSGSMNIYLVLDGSDSIGSHNFTGAKRCLSNFIEKV
ASYGVRPKYGLVTYATDPKVLIRVSDPKSSDADWVTEQLNQINYQDHKLRAGTNTKKALL
EVYNMMSREVNKLPEAWNRTRHVILLMTDGLHNMGGDPVSVIHDIRDLLDIGRNRKKPRE
DYLDIYVFGVGPLVDQDSINALASKKDKEQHVFKLKDIDNLEDVFIQMLDETRTLGLCGM
VWEHKKGTDYHKQPWQAKISVTRPLKGHESCMGAVVSEYFVLTAAHCFTVDDEKHSIKVS
MGGKKQEWEIEEVLFHPNYDLNAKKAKGIPEFYDYDVALIKLKKKLKYSETIRPICLPCT
EGSNQALRLPHSTTCQQQMQELLPAKDIKALFVSELSKDHKKTLIRKEVYIKNGEKKTGC
ERDALRAIGYDKVKDVSEVVTPRFLCTGGVAPYADPNTCKGDSGGPLFIHKKSRFIQVGV
ISWGVVDVCKGQQQVPAYARDFHINLYQVLPWLKEKLQDEDLGFL
Download sequence
Identical sequences ENSTTRP00000005589 ENSTTRP00000005589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]