SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005659 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005659
Domain Number 1 Region: 70-201
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.2e-48
Family Regulator of G-protein signaling, RGS 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005659   Gene: ENSTTRG00000005985   Transcript: ENSTTRT00000005987
Sequence length 208
Comment pep:known_by_projection scaffold:turTru1:scaffold_101134:62932:66401:-1 gene:ENSTTRG00000005985 transcript:ENSTTRT00000005987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAISTPRRDKMPGVFLSANPKELKGTDHSLLDDKTQKRRPKTFGMDVKAYLRSMIPHL
ESGMKPSKSKDLLSADEVKQWSESLEKLLANQTGQDVFGNFLKSEFSEENIEFWLACEDY
KKTESDLLHCKAEKIYKAFVQSDAAKQINIDFHTRESTAKKIKAPTPTCFDEAQRTIYTL
MEKDSYPRFLKSNIYLNLLNDLQANSLK
Download sequence
Identical sequences ENSTTRP00000005659 ENSTTRP00000005659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]