SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005696 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005696
Domain Number 1 Region: 308-590
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.83e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000121
Further Details:      
 
Domain Number 2 Region: 160-307
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-42
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00025
Further Details:      
 
Domain Number 3 Region: 592-699
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.83e-28
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 70-130
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000000937
Family TGS domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005696   Gene: ENSTTRG00000005996   Transcript: ENSTTRT00000006024
Sequence length 709
Comment pep:known_by_projection scaffold:turTru1:scaffold_91035:38422:60600:-1 gene:ENSTTRG00000005996 transcript:ENSTTRT00000006024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGVRNPVGASEEKRKEGGKKKNKEGSGDGGRAELNPWPEYINTRLEMYNKLKAEHDSILA
EKAEKDSKPIKVTLPDGKQLDAESWKTTPYQIACGISQGLADNTVIAKVNKVLWDLDRPL
EEDCTLELLKFEDEEAQAXXXXXXXXXXXXXMERVYGGCLCYSPIGNGFYYDMYLEEGGV
SSNDFSSLEALCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRC
GPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKF
QEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVIT
PNIYNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRV
ADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAIEQIEDEIKGCLDFLRTVYSIFGFSF
KLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGR
YHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPF
WLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFIL
VVGEKEKTSSTVNIRTRDNKVHGERTISETIEWLQQLKQSRSKQAEEEF
Download sequence
Identical sequences ENSTTRP00000005696 ENSTTRP00000005696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]