SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005715 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005715
Domain Number 1 Region: 409-605
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-47
Family cAMP-binding domain 0.0000931
Further Details:      
 
Domain Number 2 Region: 163-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-36
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005715   Gene: ENSTTRG00000006044   Transcript: ENSTTRT00000006043
Sequence length 688
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2551:319342:339033:1 gene:ENSTTRG00000006044 transcript:ENSTTRT00000006043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRGLAESKRSSFTSQGPASSGRIQGKKSQPEKEERSASRGRPLGGSRWHTEGNRGLWE
IALAGPHSYGSRLHSLLSRLIISLRAWAARHLRHEDQRPDSFLERFHGAELKEVSSRESH
VQNNAGSQEPPDRGRSDWPLARSNTNACNNSEKEKKKDTTVVDPSNNMYYHWLTIIAVPI
FYNWCLLVCRACFDELQSEHLMLWLVLDYSADFLYGFDVLVRARTGFLEQGLLVTDANRL
WKHYTKTLHFKLDMLSLVPTDLAYFKLGMNYPELRFNRLLKLARLFEFFDRTETRTNYPN
MFRIGNLVLYILIIIHWNACLYFAISKFIGFGTDSWVYPNISNPEYGRLSRKYIYSLYWS
TLTLTTIGETPPPVKDEEYLFVVLDFLVGVLIFATIVGNVGSMISHMNASQAEFQAKSDS
VKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEREVLKCLPDKLRAEIAISVHLDTLRK
VRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYIIKEGKLAVVAEDGVTQFV
VLSDGSYFGEISILNIKGSKSGNRRTANIRSLGYSDLFCLSRDDLMEALTEYPEAKKALE
EKGRQILMKDNLIDEELAKAGADPQGIEERVEHLESSLDTLRTRFARLLAEYSASQMRVK
QRLSQLENQAKLGLPPDGDAPQTEAKQR
Download sequence
Identical sequences ENSTTRP00000005715 ENSTTRP00000005715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]