SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005817 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005817
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily Lysozyme-like 1.85e-28
Family C-type lysozyme 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005817   Gene: ENSTTRG00000006153   Transcript: ENSTTRT00000006150
Sequence length 144
Comment pep:known_by_projection scaffold:turTru1:scaffold_107303:4332:10089:-1 gene:ENSTTRG00000006153 transcript:ENSTTRT00000006150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASMVPCLIGYLVVPSGAAVLGRGVVAKNLHGGLSDFEGYSLENWVCLTYFESKFNPTA
AYDSLRGDYTGYGFFQICNRDRCDHGKNCCHVSCSASLNPNLKETIECAKKIVKGKRGMG
AWTSWTLNCQDSDTLERWLDGCKL
Download sequence
Identical sequences ENSTTRP00000005817 ENSTTRP00000005817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]