SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005819 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005819
Domain Number 1 Region: 103-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-62
Family DBL homology domain (DH-domain) 0.0000189
Further Details:      
 
Domain Number 2 Region: 298-440
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-32
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005819   Gene: ENSTTRG00000006149   Transcript: ENSTTRT00000006152
Sequence length 1332
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1041:39179:127724:1 gene:ENSTTRG00000006149 transcript:ENSTTRT00000006152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHLGLFPQDKEAGAIKLELMPAR
PFSSSELPRDGAAAQQNTDQGSERQPWAQHRVDTNGAAKTGAESATSPKLLYVDRVVQEI
LETERTYVQDLKSIVEDYLECIRDQMKLPLGAEERSALFGNIQDIYHFNSELLQDLENCE
NDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKMLAKFFRERQETLKHSLPL
GSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHAV
RLQEIQSLLTNWKGPDLTSYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKRDDTFTYK
AHILCGNLMLVEVIPKEPLSFSVFHYQNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA
KIPAKAKQAILEMDAVHYPGFCYSPEGETKAFCGSKDGSASYRLRRKSEPSSRSHKVLKT
SETAQDIQKVSREEGSPQLTSAGPSPAQRNSQPSSSAIINVLRGGGAVRSIWTDHQIRQA
LFPSRRSPQENEEDEDDYQMFLPSFSPSDLNSARLCEDSTSSRPCSWHMGQVESSETPSS
GHRVVRRASSAGESNTCPPEIGSDSPQYSSRRELQNDPKTEGLDGMTPFGSSVELTIDDI
DHVYDNISYEDLKLMVAKREEAEAPPPKSARDSARPKSTPELAFSRPASPEKSPLHPQRD
GASPGREAWNQSSRELQVVEENVYYTIGLPEAPSQDFKCSSLKRPMRSTFLGLEADLGCC
DSLRASVSQDSLQFSEDDAPYPRDSSGNDYLSLFYNSFGCNLSIADRSISDKLSEEVDEI
WNDLENYIKKNEVKARDRLLAAFPVSKDDVQERPLAGSAPELGARPTSLPAGRAPLVPPR
DRPAGLCTLDLTPASKDSSCLSLHRLSLVSDLPPVESPYDVASSSPSPADLKNSDPGMDT
ADKTRSRVFLMARQYSQKIKKANQLLKVKSPELEQPPGSHVQKQVPRDLAAILEEKKQGG
PAIGARIAEYSQLYDQIVFRETPFKTQKDGWASPQDSSNLSSASPSHTQHGSEDWLLHST
YSNGELADFCPRPEQDSKSKYPTLEINTKSTPRQLSAACSVPSLQISEPLLGSVQRHSVV
VSQPNKENSCQGHLYNSLGRKGISAKSQPYNRSQSSSSILINKSSDSINYPSEMGKKQLL
SLHRSSRWESHQDLVPGIADSGQQGTEKHSDLTLQDSQKVLVVNRNLPLSAQIATQNYFS
NFKETEGDEDDYVEIKSEEDEPISSKLGPYLTSYNDSDKLNDYLWKGPPPNQQNIVQSLR
EKFQCLSSSSFA
Download sequence
Identical sequences ENSTTRP00000005819 ENSTTRP00000005819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]