SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005820 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005820
Domain Number 1 Region: 391-506,625-765
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.91e-68
Family Phosphate binding protein-like 0.000000000709
Further Details:      
 
Domain Number 2 Region: 15-371
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.5e-68
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005820
Domain Number - Region: 477-620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00224
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005820   Gene: ENSTTRG00000006154   Transcript: ENSTTRT00000006153
Sequence length 869
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2374:626671:1027299:1 gene:ENSTTRG00000006154 transcript:ENSTTRT00000006153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQL
SLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRA
ILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMK
RGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGF
RILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVGVQQFPQ
MTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGL
EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRF
EGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAI
TYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLF
VIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGI
WWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGTVEDGATMTFFKKSKI
STYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLI
DSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQN
IGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRVKHKP
QAPVIVKTEEVINMHTFNDRRLPGKETMA
Download sequence
Identical sequences ENSTTRP00000005820 ENSTTRP00000005820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]