SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005852 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005852
Domain Number 1 Region: 115-441
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-133
Family Myotubularin-like phosphatases 0.0000000587
Further Details:      
 
Domain Number 2 Region: 3-104
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-16
Family GRAM domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005852   Gene: ENSTTRG00000006184   Transcript: ENSTTRT00000006186
Sequence length 613
Comment pep:novel genescaffold:turTru1:GeneScaffold_1567:6388:23478:-1 gene:ENSTTRG00000006184 transcript:ENSTTRT00000006186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIALVEKLALTTSGCPL
VIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSERLRGWQLV
DLAEEYKRMGVPNSNWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKFRSKGRFPV
LSYYHQNKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPANRYMYVMDTRPRLNAMAN
RAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVSDFYSGLENAGWL
RHIKAVMDAAIFLAKAIMVENASVLVHCSDGWDRTSQVCSLGSLLLDPYYRTIRGFMVLI
EKDWISFGHKYSERCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFNEAFLLQIHEH
IHSCQFGNFIGNCQKEREELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIKQHKNKQTDGV
LTKELLNSVRPESPALKTSLCLKEQTLLPVNDALRTIEGSNPADNRYSEYADEFSKAEPA
VVSSEYGVARMTC
Download sequence
Identical sequences ENSTTRP00000005852 ENSTTRP00000005852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]