SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005862 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005862
Domain Number 1 Region: 18-137
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.06e-39
Family Regulator of G-protein signaling, RGS 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005862   Gene: ENSTTRG00000006208   Transcript: ENSTTRT00000006197
Sequence length 151
Comment pep:known_by_projection scaffold:turTru1:scaffold_91493:5543:28128:-1 gene:ENSTTRG00000006208 transcript:ENSTTRT00000006197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVKCCFHRSPTTETTVCSENMDTLLTNQAGLDAFTFLKSEFSEENAELWLACEDFKKTE
SAEKIASKAKMIYSEFIEADAPEEINIDFSTTDLISKNIAEPTLKCFDEAQQVIYSLMTK
DSFPRFLKSEIYKKLVNSKQVGNHKKWLPFL
Download sequence
Identical sequences ENSTTRP00000005862 ENSTTRP00000005862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]