SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005884 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005884
Domain Number 1 Region: 31-292,391-465
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.45e-81
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000355
Further Details:      
 
Domain Number 2 Region: 269-387
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 8.07e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000623
Further Details:      
 
Domain Number 3 Region: 482-643
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 2.75e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005884   Gene: ENSTTRG00000006226   Transcript: ENSTTRT00000006220
Sequence length 643
Comment pep:known_by_projection scaffold:turTru1:scaffold_107712:41247:56893:-1 gene:ENSTTRG00000006226 transcript:ENSTTRT00000006220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPAASHTGARSFHFTVDSSKRSSAKVSDAISTQYPVVDHEFDAVVVGAGGAGLRAAFGLS
EAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHY
MTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVTDRTGHSLL
HTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGR
TYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINS
QGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAMRLP
GISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHVGGQDQVVPGLYACGEA
ACASVHGANRLGANSLLDLVVFGRACALSIAESCKPGDKVPLIKPNAGEESVMNLDKLRF
ANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKISKLYGDLKHLKTFDRGMVWNTD
LVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKERVDEYDYSKPIQGQHKRPFEGH
WRKHTLSYVDIRTGKVSLEYRPVIDRTLNEADCATVPPAIRSY
Download sequence
Identical sequences ENSTTRP00000005884 ENSTTRP00000005884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]