SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005934 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005934
Domain Number 1 Region: 741-913
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-30
Family DBL homology domain (DH-domain) 0.0000711
Further Details:      
 
Domain Number 2 Region: 989-1061
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000123
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005934
Domain Number - Region: 199-361
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000249
Family CRAL/TRIO domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005934   Gene: ENSTTRG00000006255   Transcript: ENSTTRT00000006271
Sequence length 1182
Comment pep:known_by_projection scaffold:turTru1:scaffold_107712:94259:123861:-1 gene:ENSTTRG00000006255 transcript:ENSTTRT00000006271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTPASVEARRWFRKSYMEALQNPMPLGSSSEESIGDEACGSQTHGRRARGAGAAASLTQK
EIPGPAGDPQEIPRQENGPGAAGRTLPRRSRSWDRSLRSSRGDTWRASQHLASTRPGGLL
GGQAVGTRTTGSSCPGTVESPSCTGKEAADVSAEGSSVRGSSPSRCSDLLAEPLCPEGEA
WAPGAGDLPSRAPRQELELNQELLQSGAVTLPGTRDRQGRAVVQVCTRGPLWSSEHMSSA
ELTRLLKYLHTIPRKEVRELGLVILVDARKSLAAPALSQALAALQNTSPPLIHSILLLVD
KESAFRPDKDATIQCELVGSLKALHKFVDSSQLTADLEGSFPYSHSAWICFRRKLEPFTS
NCEEAIVFLQNSVHSLNTHRTPSTAQEVAESIGKHRAMMKHVLEDTRLVALRLEGGTVLA
RLRREEHGAGQDYQDTIEAACRLYDQVDEEVHRLVLASNRCLQALEELQEEDQYRPKGLR
LMEEDLQGAEEGTQDFRRSLSAKAGLAERREGELARQALGSEFCETVSGRTERPDPELVT
EDLKRCRRQAAEFPRASVVVVGPGGQWALPRGQTLWLQSRQTRRHWQEALGEEAPGPGTL
PLGWSPLKHELAQGPEGQPLEPSWTPPADPEGRAGEWALLPGLAGQAAACGQGEHLRPCA
RTSGTCSAHPRKHPPQKIRKKAQSFATPQLDSGPSDSLRLGHTGVFIRGLEVIGTAVASE
KRPPLRPRAESPRLPRNRSLSSPSRTHPSEEDGKQAGSSRQHVMAEMISTERQYVRSSGY
VIDNYFPEMERTDLPQDLRGKRSVIFGNWETLYAFHHGRFLPGLEHCRHRPWAVGHAFLR
YEEQLGRNALYSKNKRADALLCSHGNAFFKNKQQELGDKMDLASYLLKPVQRVGKYALLL
RALVQEAGGCPAREQALGRRWAAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKVDGGHDVYAYEQSFKMAQIRMTENVGDSGLR
FEIWFRRRRKSQDTYIRQASSAEVKTSWTDVIGKVLWWQALRSRELRTQEMVSTGIGSKP
SMDVKPSNAAISDRAISYTGKGTEARTRASTAVPSCDHTAPLKRLHSTLSDSSTSSSSSR
SSSARGPRPRPSPARYPCPCGVRTCTEQGELKQEAGPTFREV
Download sequence
Identical sequences ENSTTRP00000005934 ENSTTRP00000005934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]