SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005981 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005981
Domain Number 1 Region: 1318-1480
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-71
Family Pleckstrin-homology domain (PH domain) 0.00000383
Further Details:      
 
Domain Number 2 Region: 1101-1321
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-53
Family DBL homology domain (DH-domain) 0.0000001
Further Details:      
 
Domain Number 3 Region: 502-617
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-19
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 882-992
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000692
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005981   Gene: ENSTTRG00000006310   Transcript: ENSTTRT00000006322
Sequence length 1709
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1819:30867:145713:1 gene:ENSTTRG00000006310 transcript:ENSTTRT00000006322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYTLQGSKNHSNTITGAKQKPCSLKIRGLHTKDDKSLHGWGHGSSGAGYKSRSL
ARSCLSHFKSNQPYASRPGGPSFKVSKGSAYSKHRTNASASDFQGNDAAFSPENGFHYVG
HPPADIHAASRDCNGHFLNCYGRDQSVASTPPSEDRRPWVLIRLGQLDGWLVEFSGSMVP
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASPRRRHRPAATVARPRSSKGSSLSSES
SWYDSPWGPAGEVSEAEGSFAAPGTPEPEPGLHAGFPPRDAPKPFSQSASLSSLREPYPD
ATLGSLAPAALRLSDDYMGTRASLSARVSFASDIDVPARVERGEPGQFASFTLPCRKSRA
LSEEPSKKDTLKARMRRISDWTGSLSRKKRRLQEPRSKEGSDYFDSRSDGLNVDVQGLSQ
ASASLWSGGSAQILSHRSESAHAIGSDPLQQNIYENFMRELEMSRTNTENLETSTETAES
SSDSLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGC
TLLFYETYGKNSMDQSSAPRCALFAEDSILQAVPEHPKKENVFCLSNSFGDVYLFQATSQ
TDLENWVTAIHSACASLFAKKHGKEDTVRLLKNQTRNLVQKIDMDSKMKKMAELQLSVVS
DPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPSKLALG
RLGVLSVSSFHALVCSRDDSALRKRTLSLTQRGRHKKGLFSSLKGLDTLARKGKEKRPSI
TQIFDSSGSHGFSGTQLPQSSNNSSEVDDLLHIYGSAVDRVPRDGSWESQTDVQFQDHQA
VTVMIKPEHRVEDILTLACKMRQLEPSHYGLQLRKLVDENVEYSIPAPYEYMQEQVYDEI
EVFPLNVYDVQLTKTGGVSDFGFAVTAQVDGHQHLSRIFISDVLPGGPAYGEGLRKGNEI
MTLNGEAVSDLDLKQMEALFSEKSVELTLIARLPDTKATLCSSWSDSDLFSRDQKGLLPP
PNQSQLLEEFLDNFKKDTANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAEQI
AALCRSYNDTQTNGMEGPRESQDPPPRPLARHLSDADRLRKVIQELMDTEKSYVKDLSCL
FDLYLEPLQSETFLTQDEMESLFGSLPEMLDFQKVFLETLEDGISASADFNILETPSQFR
KLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTL
ESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYHLTEALKAMETVASHINEMQKIHEDYG
TVFDQLVAEQSGTEKEVTELSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVIL
VYKENCKLKKKLPSNSRPAHNSADLDPFKFRWLIPISALQVRLGNTAGTENNSLWELIHT
KSEIEGRPETIFQLCCSDNESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKN
RVPVSAKLASSRSLKVLKSSSSEWPGEPGKGSSLDSDEGSLSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEDPD
ARSAQQPPGGGQPKLVRGHFCAIKRKANSTKRDRGTLLKAQMRHQSLDSQSENANLDLSS
VLEREFSVQSLTSVVNEECFYETESHGKA
Download sequence
Identical sequences ENSTTRP00000005981 ENSTTRP00000005981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]