SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006013 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006013
Domain Number 1 Region: 60-126
Classification Level Classification E-value
Superfamily Ribosomal protein S18 6.8e-19
Family Ribosomal protein S18 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006013   Gene: ENSTTRG00000006354   Transcript: ENSTTRT00000006354
Sequence length 269
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1812:326877:342009:-1 gene:ENSTTRG00000006354 transcript:ENSTTRT00000006354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALNVLLSGCGRXXXXXXXXXXXXXXXXXXXXXXXXXVEIQAGKTTIIEGRITGTPKES
PNPPNPSGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRVTGLCQEEHRKIEECVK
MAHRAGRKHLGLRGAEAGCGHHFPLQLPRVPAPPERAMGIQRLHYTHPLVPTPPPWAFPP
APELHRELQRPSPFSLHSGLLPNHRPKLPEGFVPKSKPQLNRYLTRWSPRSVKPIYNKGH
RWNKVRMAVGSPLLKDNVSYASRPLVLYH
Download sequence
Identical sequences ENSTTRP00000006013 ENSTTRP00000006013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]