SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006066 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006066
Domain Number 1 Region: 506-690
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000765
Further Details:      
 
Domain Number 2 Region: 281-414
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-25
Family Pleckstrin-homology domain (PH domain) 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006066   Gene: ENSTTRG00000006410   Transcript: ENSTTRT00000006410
Sequence length 728
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2802:154815:185516:1 gene:ENSTTRG00000006410 transcript:ENSTTRT00000006410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDDAGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPAPFPPEASEPPRVV
RPEPGTRALEPPAEDRRDEVVLRQKPPTGRKVQLPPSRQMNLGFGDEPPEPEASGRGERL
GRKVAPLATTDDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTF
TFALGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRALRRLPNRVPSLR
MLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQVLTKKGKKAG
GGLRQWKRVYAALRARSLSLSKERREPGPAAAGAAAAVAGEDEAAPVCIGSCLVDISYSE
TKRRHVFRLTTADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDY
RKVSHSSGPKADSSPKGSRGLGGLKSEFLKQSTARGLRTQDQPAGSKDDSVSTPKTPWGI
NIIKKNKKAAPRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAV
VSSLQEQLNRGPGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIED
SRERMQTLRKLIRDLPGHYYETLKFLVGHLKTIADHSEKNKXEPRNLTLVFGPTLVRTSE
NIMADMVTHMDRYKIVETLIQHSDWFFSDNEDKGERTPVDDREPQSVPNIEYLLPNIGRT
VPPGEPGS
Download sequence
Identical sequences ENSTTRP00000006066 ENSTTRP00000006066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]